PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00105319001
Common NameGSBRNA2T00105319001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 329aa    MW: 36416.4 Da    PI: 6.7066
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00105319001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731185.1e-37107198297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqr+wseeDei++LqGlid++++tg+sp+dd++afy  vkksisf+vsk+q+++Ki  LK K++++  k     e +fsk+hd+k+f+l
  GSBRNA2T00105319001 107 YFQRVWSEEDEIAVLQGLIDYRNHTGASPYDDTNAFYLSVKKSISFDVSKTQVIKKIWGLKTKYENNLGK----GELTFSKPHDRKAFDL 192
                          79********************************************************************....899************* PP

               DUF573  92 skkiWg 97 
                          sk +Wg
  GSBRNA2T00105319001 193 SKFVWG 198
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.3E-32108198IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MSGKRFNPLE DPPSASSSDE DDQVKTTSLA RNSSSEEETD DESSLKSAPE KHQASDSESG  60
SDEKNPGTKD SAVVKKNHDS KKVKPLTKKR SLSERDGAAS KEAKKTYFQR VWSEEDEIAV  120
LQGLIDYRNH TGASPYDDTN AFYLSVKKSI SFDVSKTQVI KKIWGLKTKY ENNLGKGELT  180
FSKPHDRKAF DLSKFVWGAD GAALDSASKK SSKSSSKKVE PEKQELASSS SPNGKSCEEE  240
AMAYKGEASS VVEVDAFDKS VLVKALARFG VDDLSAQRGW SRLALEDKKR FEEEWKVLQL  300
RELEFYSKKS GFIHEVITKM AESFPPNP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00105319001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013685134.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A078E9T30.0A0A078E9T3_BRANA; BnaA06g07170D protein
STRINGBra019847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.17e-67DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]